PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00053.185
Common NameAMTR_s00053p00228660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family MIKC_MADS
Protein Properties Length: 189aa    MW: 21473 Da    PI: 8.3226
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00053.185genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.22.5e-29959151
                                              S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                                    SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                              k+ien + rqvtfskRr+g+lKKA+ELS+LCdaeva+iifsstgkl+e++s
  evm_27.model.AmTr_v1.0_scaffold00053.185  9 KKIENATSRQVTFSKRRAGLLKKAQELSILCDAEVALIIFSSTGKLFEFPS 59
                                              68***********************************************96 PP

2K-box65.42e-22891671795
                                     K-box  17 lqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 
                                                 +e+a L++ei +Lq  + h++G++L +LslkeLq+Le+ L++++++++++K++llleq+e++q kek
  evm_27.model.AmTr_v1.0_scaffold00053.185  89 QVKEVAVLREEIGKLQMAHMHMMGKELLNLSLKELQHLENMLNEGITSVKDRKEKLLLEQLEQSQLKEK 157
                                               4479***************************************************************** PP

                                     K-box  86 elqeenkaLr 95 
                                               ++    ++L+
  evm_27.model.AmTr_v1.0_scaffold00053.185 158 RAAVSLNNLK 167
                                               9987777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.562161IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-41160IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.68E-34276IPR002100Transcription factor, MADS-box
CDDcd002655.95E-45278No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-30323IPR002100Transcription factor, MADS-box
PfamPF003192.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-303859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.74986178IPR002487Transcription factor, K-box
PfamPF014861.9E-1490168IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010047Biological Processfruit dehiscence
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048577Biological Processnegative regulation of short-day photoperiodism, flowering
GO:0060862Biological Processnegative regulation of floral organ abscission
GO:0060867Biological Processfruit abscission
GO:0071365Biological Processcellular response to auxin stimulus
GO:2000692Biological Processnegative regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MGRGKIEIKK IENATSRQVT FSKRRAGLLK KAQELSILCD AEVALIIFSS TGKLFEFPSS  60
GMKKTLARYN QCSDSSESSL VECDFEMQQV KEVAVLREEI GKLQMAHMHM MGKELLNLSL  120
KELQHLENML NEGITSVKDR KEKLLLEQLE QSQLKEKRAA VSLNNLKYEM FYSHLDSLCA  180
YANKLHEI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-23178178Myocyte-specific enhancer factor 2B
1tqe_Q4e-23178178Myocyte-specific enhancer factor 2B
1tqe_R4e-23178178Myocyte-specific enhancer factor 2B
1tqe_S4e-23178178Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00508DAPTransfer from AT5G13790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011623002.11e-107PREDICTED: MADS-box transcription factor 23
SwissprotQ392951e-61AGL15_BRANA; Agamous-like MADS-box protein AGL15
TrEMBLW1PB861e-134W1PB86_AMBTC; Uncharacterized protein
STRINGGLYMA11G16105.14e-65(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13790.13e-48AGAMOUS-like 15
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]